PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.YE1CZ
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family B3
Protein Properties Length: 490aa    MW: 56958.1 Da    PI: 10.6397
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.YE1CZgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B341.81.9e-1327109895
                  -HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-.SSSEE..EEE CS
           B3   8 sdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld.grsefelvvk 95 
                    +l+ g++ l kkf++++g++   s  l l+ ++g +W+v+   ++++g ++++kGWkeFv    L+ g  + F+++ g+s     v+
  Araip.YE1CZ  27 RKALQDGNFKLTKKFTRQYGSV--LSNPLYLKPPDGTEWKVYW--TNHDGVILFKKGWKEFVAYYSLDHGHLLYFEYNiGTSH--IEVR 109
                  44566777***********988..7778***************..*******************************9733333..3444 PP

2B342.41.2e-132813651299
                  HTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
           B3  12 ksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                  +++  +++ kf++++ ++++++  +++     + + vkliyr +s+  ++++GW+ F++a +L++gD+++Fkl++r++  + v+++r+
  Araip.YE1CZ 281 TRAPCYFSTKFFRKYFENNPQNANIRFG---KKLFPVKLIYRPSSCVAFISAGWNLFARASKLQAGDVCLFKLINRKDPVFDVHICRR 365
                  4444577899999997676777777754...499****************************************9999989*****98 PP

3B346.19.1e-154054881299
                  HTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
           B3  12 ksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                  +++r  l+  f +++ +k++++++l++e    + W  ++iy+ +s+  ++++GW++F++a +L++gD++vF+l+++++  + v+++r+
  Araip.YE1CZ 405 RRSRPNLSAIFYRKYFKKNQQDVKLQFEK---ELWPATIIYNPSSKNSFISAGWSSFARASKLEAGDVCVFELINKKDL-FDVHICRA 488
                  45567788899999976656655555444...89****************************************87444.69999997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.102.8E-1713115IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.55E-1619121IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.96920114IPR003340B3 DNA binding domain
CDDcd100177.50E-1120112No hitNo description
SMARTSM010193.2E-721114IPR003340B3 DNA binding domain
PfamPF023622.5E-1028110IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.2E-15264365IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.58E-13265365IPR015300DNA-binding pseudobarrel domain
CDDcd100172.35E-11269364No hitNo description
SMARTSM010192.0E-5271366IPR003340B3 DNA binding domain
PfamPF023626.3E-12281366IPR003340B3 DNA binding domain
PROSITE profilePS508639.263312366IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.3E-19387489IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.57E-16388488IPR015300DNA-binding pseudobarrel domain
CDDcd100179.06E-15393487No hitNo description
SMARTSM010198.3E-12395489IPR003340B3 DNA binding domain
PfamPF023621.6E-12408488IPR003340B3 DNA binding domain
PROSITE profilePS5086310.926436489IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 490 aa     Download sequence    Send to blast
MASSSRQQNK HSPSTSTETS FFKIILRKAL QDGNFKLTKK FTRQYGSVLS NPLYLKPPDG  60
TEWKVYWTNH DGVILFKKGW KEFVAYYSLD HGHLLYFEYN IGTSHIEVRI HDMSCHQIEY  120
PANDHIKEQL PRRDQQPVKR PKESKTRDVD SSPNTQNMRL NEEQQKKRLN EPLPGGVRGQ  180
PEKKMRALVS SASKSRQLEN DTQIRDGERS LSSHGIKSKE KNHEVPVSVN QDSNGKRNRR  240
RKDSESSVRL CPARPESLKE AKKFKREKPS FIIKITQRSQ TRAPCYFSTK FFRKYFENNP  300
QNANIRFGKK LFPVKLIYRP SSCVAFISAG WNLFARASKL QAGDVCLFKL INRKDPVFDV  360
HICRRQRRES LSKPVTRVIQ LPKEAKELNS QNPSFMVKIK DSDPRRSRPN LSAIFYRKYF  420
KKNQQDVKLQ FEKELWPATI IYNPSSKNSF ISAGWSSFAR ASKLEAGDVC VFELINKKDL  480
FDVHICRAQC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016182342.10.0PREDICTED: B3 domain-containing transcription factor VRN1-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15597210
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.11e-20B3 family protein